Lineage for d5f2vy_ (5f2v Y:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007275Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins)
    Pfam PF04607; ppGpp-synthetase
  6. 3007284Protein automated matches [254696] (3 species)
    not a true protein
  7. 3007285Species Bacillus subtilis [TaxId:1415167] [278587] (2 PDB entries)
  8. 3007296Domain d5f2vy_: 5f2v Y: [279913]
    automated match to d2be3b_
    complexed with apc, mg

Details for d5f2vy_

PDB Entry: 5f2v (more details), 2.8 Å

PDB Description: crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
PDB Compounds: (Y:) GTP pyrophosphokinase YjbM

SCOPe Domain Sequences for d5f2vy_:

Sequence, based on SEQRES records: (download)

>d5f2vy_ d.218.1.8 (Y:) automated matches {Bacillus subtilis [TaxId: 1415167]}
dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi
plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqrdyiaehkesgyrsyhlv
vlyplqtvsgekhvlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasr
ldeemseirgevqea

Sequence, based on observed residues (ATOM records): (download)

>d5f2vy_ d.218.1.8 (Y:) automated matches {Bacillus subtilis [TaxId: 1415167]}
dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi
plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqsyhlvvlyplqtvsgekh
vlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasrldeemseirgevq
ea

SCOPe Domain Coordinates for d5f2vy_:

Click to download the PDB-style file with coordinates for d5f2vy_.
(The format of our PDB-style files is described here.)

Timeline for d5f2vy_: