![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.8: RelA/SpoT domain [102945] (3 proteins) Pfam PF04607; ppGpp-synthetase |
![]() | Protein automated matches [254696] (3 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1415167] [278587] (2 PDB entries) |
![]() | Domain d5f2vo_: 5f2v O: [279912] automated match to d2be3b_ complexed with apc, mg |
PDB Entry: 5f2v (more details), 2.8 Å
SCOPe Domain Sequences for d5f2vo_:
Sequence, based on SEQRES records: (download)
>d5f2vo_ d.218.1.8 (O:) automated matches {Bacillus subtilis [TaxId: 1415167]} dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdqrdyiaehkesgyrsyhlv vlyplqtvsgekhvlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasr ldeemseirgevqea
>d5f2vo_ d.218.1.8 (O:) automated matches {Bacillus subtilis [TaxId: 1415167]} dkqwerflvpyrqaveelkvklkgirtlyeyeddhspiefvtgrvkpvasilekarrksi plheietmqdiaglrimcqfvddiqivkemlfarkdftvvdgyrsyhlvvlyplqtvsge khvlveiqirtlamnfwatiehslnykysgnipekvklrlqraseaasrldeemseirge vqea
Timeline for d5f2vo_: