SCOPe 2.05: Domain d5djbh_: 5djb H:

Lineage for d5djbh_ (5djb H:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.0: automated matches [195116] (1 protein)
   not a true family

6. Protein automated matches [195117] (9 species)
   not a true protein

7. Species Haliangium ochraceum [TaxId:502025] [279894] (1 PDB entry)

8. Domain d5djbh_: 5djb H: [279902]
   automated match to d4axja_

Details for d5djbh_

PDB Entry: 5djb, 1.8 Å

PDB Description: structure of the haliangium ochraceum bmc-h shell protein

PDB Compounds: (H:) Microcompartments protein

SCOPe Domain Sequences for d5djbh_:

Sequence; same for both SEQRES and ATOM records:

>d5djbh_ d.58.56.0 (H:) automated matches {Haliangium ochraceum [TaxId: 502025]}
adalgmievrgfvgmveaadamvkaakveligyektgggyvtavvrgdvaavkaateagq
raaervgevvavhviprphvnvdaalplgrtpgm

Timeline for d5djbh_:

• d5djbh_ is new in SCOPe 2.05-stable
  
• d5djbh_ appears in SCOPe 2.06
  
• d5djbh_ appears in the current release, SCOPe 2.08