Lineage for d5djbh_ (5djb H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2956023Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2956024Protein automated matches [195117] (13 species)
    not a true protein
  7. 2956071Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries)
  8. 2956087Domain d5djbh_: 5djb H: [279902]
    automated match to d4axja_

Details for d5djbh_

PDB Entry: 5djb (more details), 1.8 Å

PDB Description: structure of the haliangium ochraceum bmc-h shell protein
PDB Compounds: (H:) Microcompartments protein

SCOPe Domain Sequences for d5djbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5djbh_ d.58.56.0 (H:) automated matches {Haliangium ochraceum [TaxId: 502025]}
adalgmievrgfvgmveaadamvkaakveligyektgggyvtavvrgdvaavkaateagq
raaervgevvavhviprphvnvdaalplgrtpgm

SCOPe Domain Coordinates for d5djbh_:

Click to download the PDB-style file with coordinates for d5djbh_.
(The format of our PDB-style files is described here.)

Timeline for d5djbh_: