Lineage for d1jac.8 (1jac H:,G:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676676Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 676694Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 676695Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)
  6. 676750Protein Jacalin [51103] (2 species)
  7. 676760Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)
  8. 676786Domain d1jac.8: 1jac H:,G: [27981]
    complexed with amg

Details for d1jac.8

PDB Entry: 1jac (more details), 2.43 Å

PDB Description: a novel mode of carbohydrate recognition in jacalin, a moraceae plant lectin with a beta-prism
PDB Compounds: (G:) jacalin, (H:) jacalin

SCOP Domain Sequences for d1jac.8:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jac.8 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgksqtvivgswgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOP Domain Coordinates for d1jac.8:

Click to download the PDB-style file with coordinates for d1jac.8.
(The format of our PDB-style files is described here.)

Timeline for d1jac.8: