SCOP 1.73: Domain d1jac.5: 1jac B:,A:

Lineage for d1jac.5 (1jac B:,A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (6 proteins)

6. Protein Jacalin [51103] (2 species)

7. Species Jackfruit (Artocarpus heterophyllus) [TaxId:3489] [51104] (10 PDB entries)

8. Domain d1jac.5: 1jac B:,A: [27978]

Details for d1jac.5

PDB Entry: 1jac, 2.43 Å

PDB Description: a novel mode of carbohydrate recognition in jacalin, a moraceae plant lectin with a beta-prism

PDB Compounds: (A:) jacalin, (B:) jacalin

SCOP Domain Sequences for d1jac.5:

Sequence; same for both SEQRES and ATOM records:

>g1jac.5 b.77.3.1 (B:,A:) Jacalin {Jackfruit (Artocarpus heterophyllus) [TaxId: 3489]}
sgksqtvivgswgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

Timeline for d1jac.5:

• d1jac.5 first appeared (with stable ids) in SCOP 1.55
  
• d1jac.5 appears in SCOP 1.71
  
• d1jac.5 appears in SCOP 1.75
  
• d1jac.5 appears in the current release, SCOPe 2.08