Lineage for d1jac.8 (1jac H:,G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17629Fold b.77: beta-Prism I [51091] (3 superfamilies)
  4. 17643Superfamily b.77.3: Mannose-binding lectins [51101] (1 family) (S)
  5. 17644Family b.77.3.1: Mannose-binding lectins [51102] (3 protein domains)
  6. 17650Protein Jacalin [51103] (1 species)
  7. 17651Species Jackfruit (Artocarpus integrifolia) [51104] (1 PDB entry)
  8. 17655Domain d1jac.8: 1jac H:,G: [27981]

Details for d1jac.8

PDB Entry: 1jac (more details), 2.43 Å

PDB Description: a novel mode of carbohydrate recognition in jacalin, a moraceae plant lectin with a beta-prism

SCOP Domain Sequences for d1jac.8:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jac.8 b.77.3.1 (H:,G:) Jacalin {Jackfruit (Artocarpus integrifolia)}
sgksqtvivgswgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

SCOP Domain Coordinates for d1jac.8:

Click to download the PDB-style file with coordinates for d1jac.8.
(The format of our PDB-style files is described here.)

Timeline for d1jac.8: