SCOP 1.63: Domain d1jac.6: 1jac D:,C:

Lineage for d1jac.6 (1jac D:,C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (1 family)

5. Family b.77.3.1: Mannose-binding lectins [51102] (4 proteins)

6. Protein Jacalin [51103] (1 species)

7. Species Jackfruit (Artocarpus integrifolia) [51104] (4 PDB entries)

8. Domain d1jac.6: 1jac D:,C: [27979]

Details for d1jac.6

PDB Entry: 1jac, 2.43 Å

PDB Description: a novel mode of carbohydrate recognition in jacalin, a moraceae plant lectin with a beta-prism

SCOP Domain Sequences for d1jac.6:

Sequence; same for both SEQRES and ATOM records:

>g1jac.6 b.77.3.1 (D:,C:) Jacalin {Jackfruit (Artocarpus integrifolia)}
sgksqtvivgswgakXgkafddgaftgireinlsynketaigdfqvvydlngspyvgqnh
ksfitgftpvkisldfpseyimevsgytgnvsgyvvvrsltfktnkktygpygvtsgtpf
nlpienglivgfkgsigywldyfsmylsl

Timeline for d1jac.6:

• d1jac.6 first appeared (with stable ids) in SCOP 1.55
  
• d1jac.6 appears in SCOP 1.61
  
• d1jac.6 appears in SCOP 1.65
  
• d1jac.6 appears in the current release, SCOPe 2.08