Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (14 species) not a true protein |
Species Escherichia coli [TaxId:83334] [279735] (2 PDB entries) |
Domain d5e4wb1: 5e4w B:12-118 [279736] Other proteins in same PDB: d5e4wa2, d5e4wb2 automated match to d2trxa_ complexed with ca, gol |
PDB Entry: 5e4w (more details), 2.8 Å
SCOPe Domain Sequences for d5e4wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e4wb1 c.47.1.1 (B:12-118) automated matches {Escherichia coli [TaxId: 83334]} dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
Timeline for d5e4wb1: