SCOPe 2.07: Domain d5e4wb1: 5e4w B:12-118

Lineage for d5e4wb1 (5e4w B:12-118)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (14 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [279735] (2 PDB entries)

8. Domain d5e4wb1: 5e4w B:12-118 [279736]
   Other proteins in same PDB: d5e4wa2, d5e4wb2
   automated match to d2trxa_
   complexed with ca, gol

Details for d5e4wb1

PDB Entry: 5e4w, 2.8 Å

PDB Description: crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail

PDB Compounds: (B:) Thioredoxin-1

SCOPe Domain Sequences for d5e4wb1:

Sequence; same for both SEQRES and ATOM records:

>d5e4wb1 c.47.1.1 (B:12-118) automated matches {Escherichia coli [TaxId: 83334]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

Timeline for d5e4wb1:

• d5e4wb1 first appeared in SCOPe 2.05, called d5e4wb_
  
• d5e4wb1 appears in SCOPe 2.06
  
• d5e4wb1 appears in the current release, SCOPe 2.08