Lineage for d5e4wb1 (5e4w B:12-118)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876219Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2876306Domain d5e4wb1: 5e4w B:12-118 [279736]
    Other proteins in same PDB: d5e4wa2, d5e4wb2
    automated match to d2trxa_
    complexed with ca, gol

Details for d5e4wb1

PDB Entry: 5e4w (more details), 2.8 Å

PDB Description: crystal structure of cpsrp43 chromodomains 2 and 3 in complex with the alb3 tail
PDB Compounds: (B:) Thioredoxin-1

SCOPe Domain Sequences for d5e4wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e4wb1 c.47.1.1 (B:12-118) Thioredoxin {Escherichia coli [TaxId: 562]}
dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d5e4wb1:

Click to download the PDB-style file with coordinates for d5e4wb1.
(The format of our PDB-style files is described here.)

Timeline for d5e4wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e4wb2