Lineage for d5e0kf_ (5e0k F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157154Protein automated matches [190054] (13 species)
    not a true protein
  7. 2157183Species Pyrococcus furiosus [TaxId:186497] [279274] (6 PDB entries)
  8. 2157206Domain d5e0kf_: 5e0k F: [279287]
    Other proteins in same PDB: d5e0ka_, d5e0kc_, d5e0ke_, d5e0kg_, d5e0ki_, d5e0kk_
    automated match to d1v8zb_
    complexed with po4

Details for d5e0kf_

PDB Entry: 5e0k (more details), 2.76 Å

PDB Description: x-ray crystal structure of tryptophan synthase complex from pyrococcus furiosus at 2.76 a
PDB Compounds: (F:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5e0kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e0kf_ c.79.1.1 (F:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d5e0kf_:

Click to download the PDB-style file with coordinates for d5e0kf_.
(The format of our PDB-style files is described here.)

Timeline for d5e0kf_: