![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
![]() | Protein automated matches [190054] (15 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [279274] (15 PDB entries) |
![]() | Domain d5e0kf_: 5e0k F: [279287] Other proteins in same PDB: d5e0ka_, d5e0kc_, d5e0ke_, d5e0kg_, d5e0ki_, d5e0kk_ automated match to d1v8zb_ complexed with po4 |
PDB Entry: 5e0k (more details), 2.76 Å
SCOPe Domain Sequences for d5e0kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e0kf_ c.79.1.1 (F:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem srdeiiivnlsgrgdkdldivlkvs
Timeline for d5e0kf_: