SCOPe 2.05: Domain d5eama_: 5eam A:

Lineage for d5eama_ (5eam A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (43 PDB entries)

8. Domain d5eama_: 5eam A: [278972]
   automated match to d2h9la_
   complexed with 5mn, btb, edo, so4, unx

Details for d5eama_

PDB Entry: 5eam, 1.8 Å

PDB Description: crystal structure of human wdr5 in complex with compound 9o

PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d5eama_:

Sequence; same for both SEQRES and ATOM records:

>d5eama_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

Timeline for d5eama_:

• d5eama_ is new in SCOPe 2.05-stable
  
• d5eama_ appears in SCOPe 2.06
  
• d5eama_ appears in the current release, SCOPe 2.08