Lineage for d5dlec_ (5dle C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130767Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 2130789Family c.44.2.0: automated matches [254256] (1 protein)
    not a true family
  6. 2130790Protein automated matches [254590] (4 species)
    not a true protein
  7. 2130791Species Borrelia burgdorferi [TaxId:224326] [278963] (1 PDB entry)
  8. 2130794Domain d5dlec_: 5dle C: [278964]
    automated match to d2r48a1
    complexed with cl, imd

Details for d5dlec_

PDB Entry: 5dle (more details), 1.55 Å

PDB Description: crystal structure from a domain (thr161-f265) from fructose-specific iiabc component (pts system) from borrelia burgdorferi
PDB Compounds: (C:) Pts system, fructose-specific iiabc component

SCOPe Domain Sequences for d5dlec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dlec_ c.44.2.0 (C:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
kaekivavtacpvgvahtyiaakkieneakkqgysirvetqgsigienalteeeiknasv
vilavdkdidekrfegkrvykvstvkainnteniikesfnapvf

SCOPe Domain Coordinates for d5dlec_:

Click to download the PDB-style file with coordinates for d5dlec_.
(The format of our PDB-style files is described here.)

Timeline for d5dlec_: