Lineage for d5acva_ (5acv A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996897Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)
  8. 2996999Domain d5acva_: 5acv A: [278799]
    automated match to d4ua4b_
    complexed with cl, oh, zn

Details for d5acva_

PDB Entry: 5acv (more details), 1.96 Å

PDB Description: vim-2-ox, discovery of novel inhibitor scaffolds against the metallo- beta-lactamase vim-2 by spr based fragment screening
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5acva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5acva_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak
ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei
pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagn
vadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

SCOPe Domain Coordinates for d5acva_:

Click to download the PDB-style file with coordinates for d5acva_.
(The format of our PDB-style files is described here.)

Timeline for d5acva_: