SCOPe 2.07: Domain d4rtxb1: 4rtx B:85-141

Lineage for d4rtxb1 (4rtx B:85-141)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)

8. Domain d4rtxb1: 4rtx B:85-141 [278758]
   Other proteins in same PDB: d4rtxa2, d4rtxb2, d4rtxc2, d4rtxd2
   automated match to d4omoa_
   complexed with epe, ni, so4; mutant

Details for d4rtxb1

PDB Entry: 4rtx, 1.32 Å

PDB Description: crystal structure of the src tyrosine kinase sh3 domain t96g/q128r mutant

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4rtxb1:

Sequence; same for both SEQRES and ATOM records:

>d4rtxb1 b.34.2.0 (B:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvapsd

Timeline for d4rtxb1:

• d4rtxb1 first appeared in SCOPe 2.05, called d4rtxb_
  
• d4rtxb1 appears in SCOPe 2.06
  
• d4rtxb1 appears in the current release, SCOPe 2.08