Lineage for d4rtxb_ (4rtx B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783887Species Chicken (Gallus gallus) [TaxId:9031] [225620] (11 PDB entries)
  8. 1783893Domain d4rtxb_: 4rtx B: [278758]
    automated match to d4omoa_
    complexed with epe, ni, so4; mutant

Details for d4rtxb_

PDB Entry: 4rtx (more details), 1.32 Å

PDB Description: crystal structure of the src tyrosine kinase sh3 domain t96g/q128r mutant
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4rtxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rtxb_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gshmtfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps
d

SCOPe Domain Coordinates for d4rtxb_:

Click to download the PDB-style file with coordinates for d4rtxb_.
(The format of our PDB-style files is described here.)

Timeline for d4rtxb_:

  • d4rtxb_ appears in periodic updates to SCOPe 2.05 starting on 2015-10-29
  • d4rtxb_ is called d4rtxb1 in SCOPe 2.06
  • d4rtxb_ appears in the current release, SCOPe 2.07, called d4rtxb1