SCOPe 2.06: Domain d4rtua1: 4rtu A:85-140

Lineage for d4rtua1 (4rtu A:85-140)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (14 PDB entries)

8. Domain d4rtua1: 4rtu A:85-140 [278742]
   Other proteins in same PDB: d4rtua2
   automated match to d4omoa_
   complexed with peg, pge, so4; mutant

Details for d4rtua1

PDB Entry: 4rtu, 2.45 Å

PDB Description: crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t96g/q128r mutant

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4rtua1:

Sequence; same for both SEQRES and ATOM records:

>d4rtua1 b.34.2.0 (A:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps

Timeline for d4rtua1:

• d4rtua1 first appeared in SCOPe 2.05, called d4rtua_
  
• d4rtua1 appears in SCOPe 2.07
  
• d4rtua1 appears in the current release, SCOPe 2.08