Lineage for d4rtua1 (4rtu A:85-140)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377486Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2377487Protein automated matches [190457] (10 species)
    not a true protein
  7. 2377519Species Chicken (Gallus gallus) [TaxId:9031] [225620] (14 PDB entries)
  8. 2377541Domain d4rtua1: 4rtu A:85-140 [278742]
    Other proteins in same PDB: d4rtua2
    automated match to d4omoa_
    complexed with peg, pge, so4; mutant

Details for d4rtua1

PDB Entry: 4rtu (more details), 2.45 Å

PDB Description: crystal structure of the intertwined form of the src tyrosine kinase sh3 domain t96g/q128r mutant
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4rtua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rtua1 b.34.2.0 (A:85-140) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvaps

SCOPe Domain Coordinates for d4rtua1:

Click to download the PDB-style file with coordinates for d4rtua1.
(The format of our PDB-style files is described here.)

Timeline for d4rtua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rtua2