Lineage for d5dkir_ (5dki R:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229688Domain d5dkir_: 5dki R: [278634]
    Other proteins in same PDB: d5dkia_, d5dkie_, d5dkig_, d5dkii_, d5dkij_, d5dkik_, d5dkil_, d5dkin_, d5dkio_, d5dkis_, d5dkiu_, d5dkiw_, d5dkix_, d5dkiy_, d5dkiz_
    automated match to d1rype_
    complexed with 5bz, cl, mg

Details for d5dkir_

PDB Entry: 5dki (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with alkyne-pi
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5dkir_:

Sequence, based on SEQRES records: (download)

>d5dkir_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5dkir_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5dkir_:

Click to download the PDB-style file with coordinates for d5dkir_.
(The format of our PDB-style files is described here.)

Timeline for d5dkir_: