SCOPe 2.08: Domain d5dkih_: 5dki H:

Lineage for d5dkih_ (5dki H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)

8. Domain d5dkih_: 5dki H: [278621]
   Other proteins in same PDB: d5dkia_, d5dkic2, d5dkie_, d5dkig_, d5dkii_, d5dkij_, d5dkik_, d5dkil_, d5dkin_, d5dkio_, d5dkiq2, d5dkis_, d5dkiu_, d5dkiw_, d5dkix_, d5dkiy_, d5dkiz_
   automated match to d4r17h_
   complexed with 5bz, cl, mg

Details for d5dkih_

PDB Entry: 5dki, 2.8 Å

PDB Description: yeast 20s proteasome in complex with alkyne-pi

PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5dkih_:

Sequence; same for both SEQRES and ATOM records:

>d5dkih_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

Timeline for d5dkih_:

• d5dkih_ first appeared in SCOPe 2.05
  
• d5dkih_ appears in SCOPe 2.07