SCOPe 2.07: Domain d5ce9a_: 5ce9 A:

Lineage for d5ce9a_ (5ce9 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.2: Catechol oxidase [48061] (2 proteins)

6. Protein automated matches [190909] (2 species)
   not a true protein

7. Species Juglans regia [TaxId:51240] [278546] (1 PDB entry)

8. Domain d5ce9a_: 5ce9 A: [278548]
   automated match to d2p3xa_
   complexed with cu, na, o

Details for d5ce9a_

PDB Entry: 5ce9, 1.8 Å

PDB Description: structure of tyrosinase from walnut (juglans regia)

PDB Compounds: (A:) polyphenol oxidase

SCOPe Domain Sequences for d5ce9a_:

Sequence; same for both SEQRES and ATOM records:

>d5ce9a_ a.86.1.2 (A:) automated matches {Juglans regia [TaxId: 51240]}
dpvsapeltlcseadlpagalpvnccpptskkikdfvlpsqntplrvrpaahlvdndyia
kynkgielmkslpaddprsftqqanvhcaycdgaytqvgfpdlslqihecwlffpfhryy
vyffekilgkligdptfalpfwnwdsppgmqlpslyavsnsaiydplrnanhqpptiidl
dygetsesttttdqvpsnlkimyrqmvsgaknptlffgspyragdepdpgagtiestphn
nihlwtgddtqpnienmgnfysagrdpiffahhsnvdrmwtiwktlggkrkditdpdwln
ssfffydenadpvrvkvkdcvdntklryvyqdveipwlk

Timeline for d5ce9a_:

• d5ce9a_ first appeared in SCOPe 2.05
  
• d5ce9a_ appears in SCOPe 2.06
  
• d5ce9a_ appears in the current release, SCOPe 2.08