Lineage for d5ce9a_ (5ce9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719441Family a.86.1.2: Catechol oxidase [48061] (2 proteins)
  6. 2719451Protein automated matches [190909] (2 species)
    not a true protein
  7. 2719454Species Juglans regia [TaxId:51240] [278546] (1 PDB entry)
  8. 2719455Domain d5ce9a_: 5ce9 A: [278548]
    automated match to d2p3xa_
    complexed with cu, na, o

Details for d5ce9a_

PDB Entry: 5ce9 (more details), 1.8 Å

PDB Description: structure of tyrosinase from walnut (juglans regia)
PDB Compounds: (A:) polyphenol oxidase

SCOPe Domain Sequences for d5ce9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ce9a_ a.86.1.2 (A:) automated matches {Juglans regia [TaxId: 51240]}
dpvsapeltlcseadlpagalpvnccpptskkikdfvlpsqntplrvrpaahlvdndyia
kynkgielmkslpaddprsftqqanvhcaycdgaytqvgfpdlslqihecwlffpfhryy
vyffekilgkligdptfalpfwnwdsppgmqlpslyavsnsaiydplrnanhqpptiidl
dygetsesttttdqvpsnlkimyrqmvsgaknptlffgspyragdepdpgagtiestphn
nihlwtgddtqpnienmgnfysagrdpiffahhsnvdrmwtiwktlggkrkditdpdwln
ssfffydenadpvrvkvkdcvdntklryvyqdveipwlk

SCOPe Domain Coordinates for d5ce9a_:

Click to download the PDB-style file with coordinates for d5ce9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ce9a_: