![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
![]() | Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) ![]() duplication: contains two structural repeats |
![]() | Family a.86.1.2: Catechol oxidase [48061] (2 proteins) |
![]() | Protein automated matches [190909] (2 species) not a true protein |
![]() | Species Juglans regia [TaxId:51240] [278546] (1 PDB entry) |
![]() | Domain d5ce9a_: 5ce9 A: [278548] automated match to d2p3xa_ complexed with cu, na, o |
PDB Entry: 5ce9 (more details), 1.8 Å
SCOPe Domain Sequences for d5ce9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ce9a_ a.86.1.2 (A:) automated matches {Juglans regia [TaxId: 51240]} dpvsapeltlcseadlpagalpvnccpptskkikdfvlpsqntplrvrpaahlvdndyia kynkgielmkslpaddprsftqqanvhcaycdgaytqvgfpdlslqihecwlffpfhryy vyffekilgkligdptfalpfwnwdsppgmqlpslyavsnsaiydplrnanhqpptiidl dygetsesttttdqvpsnlkimyrqmvsgaknptlffgspyragdepdpgagtiestphn nihlwtgddtqpnienmgnfysagrdpiffahhsnvdrmwtiwktlggkrkditdpdwln ssfffydenadpvrvkvkdcvdntklryvyqdveipwlk
Timeline for d5ce9a_: