SCOPe 2.07: Domain d4rldc1: 4rld C:-4-327

Lineage for d4rldc1 (4rld C:-4-327)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.0: automated matches [191552] (1 protein)
   not a true family

6. Protein automated matches [190954] (12 species)
   not a true protein

7. Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)

8. Domain d4rldc1: 4rld C:-4-327 [278405]
   Other proteins in same PDB: d4rlda2, d4rldb2, d4rldc2, d4rldd2
   automated match to d1yg9a_
   complexed with nag, zn; mutant

Details for d4rldc1

PDB Entry: 4rld, 2.9 Å

PDB Description: crystal structure of kkf mutant of bla g 2 protein

PDB Compounds: (C:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d4rldc1:

Sequence; same for both SEQRES and ATOM records:

>d4rldc1 b.50.1.0 (C:-4-327) automated matches {Blattella germanica [TaxId: 6973]}
vplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqkyekl
kpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsadvvv
giaapgcpnalagktvlenfveenliapvfsihharfqdgehygeiifggsdwkyvdgef
tyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaigcvve
ktttrrickldcsaipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsdhffi
gdffvdhyysefnwenktmgfgrsve

Timeline for d4rldc1:

• d4rldc1 first appeared in SCOPe 2.05, called d4rldc_
  
• d4rldc1 appears in SCOPe 2.06
  
• d4rldc1 appears in the current release, SCOPe 2.08