SCOPe 2.07: Domain d4jkka1: 4jkk A:1-178

Lineage for d4jkka1 (4jkk A:1-178)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (49 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:208435] [278382] (2 PDB entries)

8. Domain d4jkka1: 4jkk A:1-178 [278385]
   Other proteins in same PDB: d4jkka2, d4jkka3, d4jkka4
   automated match to d4jkmb1
   complexed with mg

Details for d4jkka1

PDB Entry: 4jkk, 2.59 Å

PDB Description: crystal structure of streptococcus agalactiae beta-glucuronidase in space group i222

PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkka1:

Sequence; same for both SEQRES and ATOM records:

>d4jkka1 b.18.1.0 (A:1-178) automated matches {Streptococcus agalactiae [TaxId: 208435]}
mlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyigdf
wyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynnek
ikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk

Timeline for d4jkka1:

• d4jkka1 first appeared in SCOPe 2.05
  
• d4jkka1 appears in SCOPe 2.06
  
• d4jkka1 appears in the current release, SCOPe 2.08