Lineage for d4jkka1 (4jkk A:1-178)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775418Species Streptococcus agalactiae [TaxId:208435] [278382] (2 PDB entries)
  8. 2775421Domain d4jkka1: 4jkk A:1-178 [278385]
    Other proteins in same PDB: d4jkka2, d4jkka3, d4jkka4
    automated match to d4jkmb1
    complexed with mg

Details for d4jkka1

PDB Entry: 4jkk (more details), 2.59 Å

PDB Description: crystal structure of streptococcus agalactiae beta-glucuronidase in space group i222
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkka1 b.18.1.0 (A:1-178) automated matches {Streptococcus agalactiae [TaxId: 208435]}
mlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyigdf
wyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynnek
ikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk

SCOPe Domain Coordinates for d4jkka1:

Click to download the PDB-style file with coordinates for d4jkka1.
(The format of our PDB-style files is described here.)

Timeline for d4jkka1: