| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Streptococcus agalactiae [TaxId:208435] [278382] (2 PDB entries) |
| Domain d4jkka1: 4jkk A:1-178 [278385] Other proteins in same PDB: d4jkka2, d4jkka3, d4jkka4 automated match to d4jkmb1 complexed with mg |
PDB Entry: 4jkk (more details), 2.59 Å
SCOPe Domain Sequences for d4jkka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkka1 b.18.1.0 (A:1-178) automated matches {Streptococcus agalactiae [TaxId: 208435]}
mlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyigdf
wyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynnek
ikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk
Timeline for d4jkka1: