Lineage for d5e26b2 (5e26 B:357-568)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858644Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)
  8. 1858741Domain d5e26b2: 5e26 B:357-568 [278365]
    automated match to d3smpb2
    complexed with adp, cl, gol, pau, unx

Details for d5e26b2

PDB Entry: 5e26 (more details), 2.14 Å

PDB Description: crystal structure of human pank2: the catalytic core domain in complex with pantothenate and adenosine diphosphate
PDB Compounds: (B:) Pantothenate kinase 2, mitochondrial

SCOPe Domain Sequences for d5e26b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e26b2 c.55.1.0 (B:357-568) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsqcyyfenpadsekcqklpfdlknpyplllvnigsgvsilavyskdnykrvtgtslggg
tffglcclltgcttfeealemasrgdstkvdklvrdiyggdyerfglpgwavassfgnmm
skekreavskedlaratlititnnigsiarmcalneninqvvfvgnflrintiamrllay
aldywskgqlkalfsehegyfgavgallellk

SCOPe Domain Coordinates for d5e26b2:

Click to download the PDB-style file with coordinates for d5e26b2.
(The format of our PDB-style files is described here.)

Timeline for d5e26b2: