Lineage for d3smpb2 (3smp B:382-594)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.14: Fumble-like [159623] (4 proteins)
Pfam PF03630; type II pantothenate kinase-like
Protein Pantothenate kinase 1, PANK1 [159628] (1 species) Species Human (Homo sapiens) [TaxId:9606] [159629] (2 PDB entries)
Uniprot Q8TE04 236-381! Uniprot Q8TE04 382-593
Domain d3smpb2: 3smp B:382-594 [233587]
automated match to d2i7na2
complexed with aco, ars, cl, unx
Details for d3smpb2
PDB Entry: 3smp (more details), 1.9 Å
PDB Description: Monoclinic crystal structure of human pantothenate kinase 1 alpha
PDB Compounds: (B:) Pantothenate kinase 1SCOPe Domain Sequences for d3smpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3smpb2 c.55.1.14 (B:382-594) Pantothenate kinase 1, PANK1 {Human (Homo sapiens) [TaxId: 9606]}
kpecyyfenptnpelcqkkpycldnpypmllvnmgsgvsilavyskdnykrvtgtslggg
tflglcclltgcetfeealemaakgdstnvdklvkdiyggdyerfglqgsavassfgnmm
skekrdsiskedlaratlvtitnnigsiarmcalnenidrvvfvgnflrinmvsmkllay
amdfwskgqlkalflehegyfgavgallelfkm
SCOPe Domain Coordinates for d3smpb2:
Click to download the PDB-style file with coordinates for d3smpb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3smpb2:
- d3smpb2 first appeared in SCOPe 2.03
- d3smpb2 appears in SCOPe 2.04
- d3smpb2 appears in SCOPe 2.06
- d3smpb2 appears in the current release, SCOPe 2.08
View in 3D
