SCOPe 2.05: Domain d5e26a1: 5e26 A:208-356

Lineage for d5e26a1 (5e26 A:208-356)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)

8. Domain d5e26a1: 5e26 A:208-356 [278360]
   automated match to d3smpb1
   complexed with adp, cl, gol, pau, unx

Details for d5e26a1

PDB Entry: 5e26, 2.14 Å

PDB Description: crystal structure of human pank2: the catalytic core domain in complex with pantothenate and adenosine diphosphate

PDB Compounds: (A:) Pantothenate kinase 2, mitochondrial

SCOPe Domain Sequences for d5e26a1:

Sequence; same for both SEQRES and ATOM records:

>d5e26a1 c.55.1.0 (A:208-356) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rplfpwfgldiggtlvklvyfepkditaeeeeeeveslksirkyltsnvaygstgirdvh
lelkdltlcgrkgnlhfirfpthdmpafiqmgrdknfsslhtvfcatgggaykfeqdflt
igdlqlckldeldclikgilyidsvgfng

Timeline for d5e26a1:

• d5e26a1 is new in SCOPe 2.05-stable
  
• d5e26a1 appears in SCOPe 2.06
  
• d5e26a1 appears in the current release, SCOPe 2.08