SCOPe 2.07: Domain d4yp6b1: 4yp6 B:4-171

Lineage for d4yp6b1 (4yp6 B:4-171)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [278213] (3 PDB entries)

8. Domain d4yp6b1: 4yp6 B:4-171 [278214]
   Other proteins in same PDB: d4yp6a2, d4yp6b2, d4yp6c2
   automated match to d1m8ga_
   complexed with nap

Details for d4yp6b1

PDB Entry: 4yp6, 1.9 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nmnat in complex with nadp

PDB Compounds: (B:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d4yp6b1:

Sequence; same for both SEQRES and ATOM records:

>d4yp6b1 c.26.1.3 (B:4-171) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanothermobacter thermautotrophicus [TaxId: 187420]}
mrgllvgkmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltkal
sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
lfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlak

Timeline for d4yp6b1:

• d4yp6b1 first appeared in SCOPe 2.05, called d4yp6b_
  
• d4yp6b1 appears in SCOPe 2.06
  
• d4yp6b1 appears in the current release, SCOPe 2.08