Lineage for d4ucsa_ (4ucs A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979381Family d.142.2.0: automated matches [227263] (1 protein)
    not a true family
  6. 2979382Protein automated matches [227054] (5 species)
    not a true protein
  7. 2979385Species Haemophilus influenzae [TaxId:727] [226055] (8 PDB entries)
  8. 2979386Domain d4ucsa_: 4ucs A: [278165]
    automated match to d1taea_
    complexed with 9mj, iwh

Details for d4ucsa_

PDB Entry: 4ucs (more details), 1.9 Å

PDB Description: fragment bound to h.influenza nad dependent dna ligase
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4ucsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ucsa_ d.142.2.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mtniqtqldnlrktlrqyeyeyhvldnpsvpdseydrlfhqlkalelehpefltsdsptq
rvgakplsgfsqirheipmlsldnafsdaefnafvkriedrlillpkpltfccepkldgl
avsilyvngeltqaatrgdgttgeditanirtirnvplqlltdnpparlevrgevfmpha
gferlnkyalehnektfanprnaaagslrqldpnitskrplvlnaygigiaegvdlptth
yarlqwlksigipvnpeirlcngadevlgfyrdiqnkrsslgydidgtvlkindialqne
lgfiskaprwaiaykfp

SCOPe Domain Coordinates for d4ucsa_:

Click to download the PDB-style file with coordinates for d4ucsa_.
(The format of our PDB-style files is described here.)

Timeline for d4ucsa_: