SCOPe 2.05: Domain d4ucsa_: 4ucs A:

Lineage for d4ucsa_ (4ucs A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families)
   has a circularly permuted topology

5. Family d.142.2.0: automated matches [227263] (1 protein)
   not a true family

6. Protein automated matches [227054] (4 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [226055] (8 PDB entries)

8. Domain d4ucsa_: 4ucs A: [278165]
   automated match to d1taea_
   complexed with 9mj, iwh

Details for d4ucsa_

PDB Entry: 4ucs, 1.9 Å

PDB Description: fragment bound to h.influenza nad dependent dna ligase

PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4ucsa_:

Sequence; same for both SEQRES and ATOM records:

>d4ucsa_ d.142.2.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]}
mtniqtqldnlrktlrqyeyeyhvldnpsvpdseydrlfhqlkalelehpefltsdsptq
rvgakplsgfsqirheipmlsldnafsdaefnafvkriedrlillpkpltfccepkldgl
avsilyvngeltqaatrgdgttgeditanirtirnvplqlltdnpparlevrgevfmpha
gferlnkyalehnektfanprnaaagslrqldpnitskrplvlnaygigiaegvdlptth
yarlqwlksigipvnpeirlcngadevlgfyrdiqnkrsslgydidgtvlkindialqne
lgfiskaprwaiaykfp

Timeline for d4ucsa_:

• d4ucsa_ is new in SCOPe 2.05-stable
  
• d4ucsa_ appears in SCOPe 2.06
  
• d4ucsa_ appears in the current release, SCOPe 2.08