Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) has a circularly permuted topology |
Family d.142.2.0: automated matches [227263] (1 protein) not a true family |
Protein automated matches [227054] (4 species) not a true protein |
Species Haemophilus influenzae [TaxId:727] [226055] (8 PDB entries) |
Domain d4ucsa_: 4ucs A: [278165] automated match to d1taea_ complexed with 9mj, iwh |
PDB Entry: 4ucs (more details), 1.9 Å
SCOPe Domain Sequences for d4ucsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ucsa_ d.142.2.0 (A:) automated matches {Haemophilus influenzae [TaxId: 727]} mtniqtqldnlrktlrqyeyeyhvldnpsvpdseydrlfhqlkalelehpefltsdsptq rvgakplsgfsqirheipmlsldnafsdaefnafvkriedrlillpkpltfccepkldgl avsilyvngeltqaatrgdgttgeditanirtirnvplqlltdnpparlevrgevfmpha gferlnkyalehnektfanprnaaagslrqldpnitskrplvlnaygigiaegvdlptth yarlqwlksigipvnpeirlcngadevlgfyrdiqnkrsslgydidgtvlkindialqne lgfiskaprwaiaykfp
Timeline for d4ucsa_: