SCOPe 2.04: Domain d1f8ab1: 1f8a B:1-42

Lineage for d1f8ab1 (1f8a B:1-42)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries)

8. Domain d1f8ab1: 1f8a B:1-42 [27803]
   Other proteins in same PDB: d1f8ab2

Details for d1f8ab1

PDB Entry: 1f8a, 1.84 Å

PDB Description: structural basis for the phosphoserine-proline recognition by group iv ww domains

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d1f8ab1:

Sequence; same for both SEQRES and ATOM records:

>d1f8ab1 b.72.1.1 (B:1-42) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
gshgmadeeklppgwekrmsrssgrvyyfnhitnasqwerps

Timeline for d1f8ab1:

• d1f8ab1 first appeared (with stable ids) in SCOP 1.55
  
• d1f8ab1 appears in SCOPe 2.03
  
• d1f8ab1 appears in SCOPe 2.05
  
• d1f8ab1 appears in the current release, SCOPe 2.08