Lineage for d1f8ab1 (1f8a B:1-42)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328562Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1328563Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1328564Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1328600Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 1328601Species Human (Homo sapiens) [TaxId:9606] [51048] (35 PDB entries)
  8. 1328618Domain d1f8ab1: 1f8a B:1-42 [27803]
    Other proteins in same PDB: d1f8ab2

Details for d1f8ab1

PDB Entry: 1f8a (more details), 1.84 Å

PDB Description: structural basis for the phosphoserine-proline recognition by group iv ww domains
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d1f8ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8ab1 b.72.1.1 (B:1-42) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
gshgmadeeklppgwekrmsrssgrvyyfnhitnasqwerps

SCOPe Domain Coordinates for d1f8ab1:

Click to download the PDB-style file with coordinates for d1f8ab1.
(The format of our PDB-style files is described here.)

Timeline for d1f8ab1: