SCOPe 2.07: Domain d5bqub1: 5bqu B:10-151

Lineage for d5bqub1 (5bqu B:10-151)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (9 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)

8. Domain d5bqub1: 5bqu B:10-151 [278012]
   Other proteins in same PDB: d5bqua3, d5bqub3
   automated match to d4lo0a1
   complexed with fru, gal

Details for d5bqub1

PDB Entry: 5bqu, 2.38 Å

PDB Description: crystal structure of ha17-ha33-lactulose

PDB Compounds: (B:) ha-33

SCOPe Domain Sequences for d5bqub1:

Sequence; same for both SEQRES and ATOM records:

>d5bqub1 b.42.2.0 (B:10-151) automated matches {Clostridium botulinum [TaxId: 1491]}
slndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihnt
nlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlkl
stlnnsnyikfiiedyiisdln

Timeline for d5bqub1:

• d5bqub1 first appeared in SCOPe 2.05
  
• d5bqub1 appears in SCOPe 2.06
  
• d5bqub1 appears in the current release, SCOPe 2.08