Lineage for d5aavb_ (5aav B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748003Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)
  8. 1748126Domain d5aavb_: 5aav B: [278004]
    automated match to d3erta_
    complexed with gw5

Details for d5aavb_

PDB Entry: 5aav (more details), 1.95 Å

PDB Description: optimization of a novel binding motif to to (e)-3-(3,5- difluoro-4-((1r,3r)-2-(2-fluoro-2-methylpropyl)-3-methyl-2, 3,4,9-tetrahydro-1h-pyrido(3,4-b)indol-1-yl)phenyl)acrylic acid (azd9496), a potent and orally bioavailable selective estrogen receptor downregulator and antagonist
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d5aavb_:

Sequence, based on SEQRES records: (download)

>d5aavb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld

Sequence, based on observed residues (ATOM records): (download)

>d5aavb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyserpfseasmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksmveifdmllats
srfrmmnlqgeefvclksiillnsgkdhihrvldkitdtlihlmakagltlqqqhqrlaq
lllilshirhmsnkgmehlyydlllemld

SCOPe Domain Coordinates for d5aavb_:

Click to download the PDB-style file with coordinates for d5aavb_.
(The format of our PDB-style files is described here.)

Timeline for d5aavb_: