SCOPe 2.08: Domain d5aavb_: 5aav B:

Lineage for d5aavb_ (5aav B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d5aavb_: 5aav B: [278004]
   Other proteins in same PDB: d5aava2
   automated match to d3erta_
   complexed with gw5

Details for d5aavb_

PDB Entry: 5aav, 1.95 Å

PDB Description: optimization of a novel binding motif to to (e)-3-(3,5- difluoro-4-((1r,3r)-2-(2-fluoro-2-methylpropyl)-3-methyl-2, 3,4,9-tetrahydro-1h-pyrido(3,4-b)indol-1-yl)phenyl)acrylic acid (azd9496), a potent and orally bioavailable selective estrogen receptor downregulator and antagonist

PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d5aavb_:

Sequence, based on SEQRES records:

>d5aavb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydlllemld

Sequence, based on observed residues (ATOM records):

>d5aavb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyserpfseasmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksmveifdmllats
srfrmmnlqgeefvclksiillnsgkdhihrvldkitdtlihlmakagltlqqqhqrlaq
lllilshirhmsnkgmehlyydlllemld

Timeline for d5aavb_:

• d5aavb_ first appeared in SCOPe 2.05
  
• d5aavb_ appears in SCOPe 2.07