Lineage for d1jdc_1 (1jdc 358-418)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63105Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species)
  7. 63106Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries)
  8. 63108Domain d1jdc_1: 1jdc 358-418 [27789]
    Other proteins in same PDB: d1jdc_2

Details for d1jdc_1

PDB Entry: 1jdc (more details), 1.9 Å

PDB Description: mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 1)

SCOP Domain Sequences for d1jdc_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdc_1 b.71.1.1 (358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri}
radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr
s

SCOP Domain Coordinates for d1jdc_1:

Click to download the PDB-style file with coordinates for d1jdc_1.
(The format of our PDB-style files is described here.)

Timeline for d1jdc_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jdc_2