Lineage for d1jdc_1 (1jdc 358-418)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species) Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries) 
Domain d1jdc_1: 1jdc 358-418 [27789]
Other proteins in same PDB: d1jdc_2
Details for d1jdc_1
PDB Entry: 1jdc (more details), 1.9 Å
PDB Description: mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 1)
SCOP Domain Sequences for d1jdc_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdc_1 b.71.1.1 (358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri}
radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr
s
SCOP Domain Coordinates for d1jdc_1:
Click to download the PDB-style file with coordinates for d1jdc_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jdc_1:
- d1jdc_1 appears in SCOP 1.57
- d1jdc_1 appears in the current release, SCOPe 2.08, called d1jdca1
View in 3D
