Lineage for d5cpgb_ (5cpg B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551585Species Pseudomonas aeruginosa [TaxId:287] [277852] (1 PDB entry)
  8. 2551587Domain d5cpgb_: 5cpg B: [277855]
    automated match to d1iq6a_
    complexed with gol

Details for d5cpgb_

PDB Entry: 5cpg (more details), 1.69 Å

PDB Description: r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form
PDB Compounds: (B:) (r)-specific enoyl-coa hydratase

SCOPe Domain Sequences for d5cpgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cpgb_ d.38.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sqvqnipyaelevgqkaeytssiaerdlqlfaavsgdrnpvhldaayaattqfkeriahg
mlsgalisaaiatvlpgpgtiylgqtlrftrpvklgddlkvelevleklpknrvrmatrv
fnqagkqvvdgeaeimapeeklsvelaelppisig

SCOPe Domain Coordinates for d5cpgb_:

Click to download the PDB-style file with coordinates for d5cpgb_.
(The format of our PDB-style files is described here.)

Timeline for d5cpgb_: