Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (41 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [277852] (1 PDB entry) |
Domain d5cpgb_: 5cpg B: [277855] automated match to d1iq6a_ complexed with gol |
PDB Entry: 5cpg (more details), 1.69 Å
SCOPe Domain Sequences for d5cpgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cpgb_ d.38.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} sqvqnipyaelevgqkaeytssiaerdlqlfaavsgdrnpvhldaayaattqfkeriahg mlsgalisaaiatvlpgpgtiylgqtlrftrpvklgddlkvelevleklpknrvrmatrv fnqagkqvvdgeaeimapeeklsvelaelppisig
Timeline for d5cpgb_: