SCOPe 2.06: Domain d5cpgb_: 5cpg B:

Lineage for d5cpgb_ (5cpg B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (36 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [277852] (1 PDB entry)

8. Domain d5cpgb_: 5cpg B: [277855]
   automated match to d1iq6a_
   complexed with gol

Details for d5cpgb_

PDB Entry: 5cpg, 1.69 Å

PDB Description: r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form

PDB Compounds: (B:) (r)-specific enoyl-coa hydratase

SCOPe Domain Sequences for d5cpgb_:

Sequence; same for both SEQRES and ATOM records:

>d5cpgb_ d.38.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sqvqnipyaelevgqkaeytssiaerdlqlfaavsgdrnpvhldaayaattqfkeriahg
mlsgalisaaiatvlpgpgtiylgqtlrftrpvklgddlkvelevleklpknrvrmatrv
fnqagkqvvdgeaeimapeeklsvelaelppisig

Timeline for d5cpgb_:

• d5cpgb_ first appeared in SCOPe 2.05
  
• d5cpgb_ appears in SCOPe 2.07
  
• d5cpgb_ appears in the current release, SCOPe 2.08