Lineage for d6taa_1 (6taa 382-476)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233630Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 233631Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 233632Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 233779Protein Fungal alpha-amylase [51028] (2 species)
  7. 233782Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51030] (3 PDB entries)
  8. 233784Domain d6taa_1: 6taa 382-476 [27779]
    Other proteins in same PDB: d6taa_2
    complexed with ca

Details for d6taa_1

PDB Entry: 6taa (more details), 2.1 Å

PDB Description: structure and molecular model refinement of aspergillus oryzae (taka) alpha-amylase: an application of the simulated-annealing method

SCOP Domain Sequences for d6taa_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6taa_1 b.71.1.1 (382-476) Fungal alpha-amylase {Aspergillus oryzae, Taka-amylase}
yknwpiykddttiamrkgtdgsqivtilsnkgasgdsytlslsgagytagqqltevigct
tvtvgsdgnvpvpmagglprvlypteklagskics

SCOP Domain Coordinates for d6taa_1:

Click to download the PDB-style file with coordinates for d6taa_1.
(The format of our PDB-style files is described here.)

Timeline for d6taa_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6taa_2