SCOPe 2.08: Domain d1bvnp1: 1bvn P:404-496

Lineage for d1bvnp1 (1bvn P:404-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)

8. Domain d1bvnp1: 1bvn P:404-496 [27767]
   Other proteins in same PDB: d1bvnp2, d1bvnt_
   complexed with ca, cl

Details for d1bvnp1

PDB Entry: 1bvn, 2.5 Å

PDB Description: pig pancreatic alpha-amylase in complex with the proteinaceous inhibitor tendamistat

PDB Compounds: (P:) protein (alpha-amylase)

SCOPe Domain Sequences for d1bvnp1:

Sequence; same for both SEQRES and ATOM records:

>d1bvnp1 b.71.1.1 (P:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl

Timeline for d1bvnp1:

• d1bvnp1 first appeared (with stable ids) in SCOP 1.55
  
• d1bvnp1 appears in SCOPe 2.07