![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.5: alpha-Amylase inhibitor tendamistat [49497] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.5.1: alpha-Amylase inhibitor tendamistat [49498] (1 family) ![]() automatically mapped to Pfam PF01356 |
![]() | Family b.5.1.1: alpha-Amylase inhibitor tendamistat [49499] (1 protein) |
![]() | Protein alpha-Amylase inhibitor tendamistat [49500] (1 species) |
![]() | Species Streptomyces tendae [TaxId:1932] [49501] (6 PDB entries) |
![]() | Domain d1bvnt_: 1bvn T: [22834] Other proteins in same PDB: d1bvnp1, d1bvnp2 complexed with ca, cl |
PDB Entry: 1bvn (more details), 2.5 Å
SCOPe Domain Sequences for d1bvnt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvnt_ b.5.1.1 (T:) alpha-Amylase inhibitor tendamistat {Streptomyces tendae [TaxId: 1932]} vsepapscvtlyqswrysqadngcaetvtvkvvyeddteglcyavapgqittvgdgyigs hgharylarcl
Timeline for d1bvnt_: