| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Growth factor receptor-bound protein 7 [103135] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [103136] (4 PDB entries) |
| Domain d4wwqa_: 4wwq A: [277333] Other proteins in same PDB: d4wwqb2 automated match to d1mw4a_ complexed with mla |
PDB Entry: 4wwq (more details), 1.8 Å
SCOPe Domain Sequences for d4wwqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wwqa_ d.93.1.1 (A:) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
lsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchlqkvkhy
lilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval
Timeline for d4wwqa_: