Lineage for d4wwqa_ (4wwq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965460Protein Growth factor receptor-bound protein 7 [103135] (1 species)
  7. 2965461Species Human (Homo sapiens) [TaxId:9606] [103136] (4 PDB entries)
  8. 2965466Domain d4wwqa_: 4wwq A: [277333]
    Other proteins in same PDB: d4wwqb2
    automated match to d1mw4a_
    complexed with mla

Details for d4wwqa_

PDB Entry: 4wwq (more details), 1.8 Å

PDB Description: apo structure of the grb7 sh2 domain
PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d4wwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwqa_ d.93.1.1 (A:) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]}
lsaaihrtqlwfhgrisreesqrligqqglvdglflvresqrnpqgfvlslchlqkvkhy
lilpseeegrlyfsmddgqtrftdllqlvefhqlnrgilpcllrhcctrval

SCOPe Domain Coordinates for d4wwqa_:

Click to download the PDB-style file with coordinates for d4wwqa_.
(The format of our PDB-style files is described here.)

Timeline for d4wwqa_: