Lineage for d4s2ga_ (4s2g A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051349Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2051462Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)
  8. 2051480Domain d4s2ga_: 4s2g A: [277303]
    automated match to d1enxa_
    complexed with dod, iod

Details for d4s2ga_

PDB Entry: 4s2g (more details), 1.6 Å

PDB Description: joint x-ray/neutron structure of trichoderma reesei xylanase ii at ph 5.8
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4s2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s2ga_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d4s2ga_:

Click to download the PDB-style file with coordinates for d4s2ga_.
(The format of our PDB-style files is described here.)

Timeline for d4s2ga_: