PDB entry 4s2g

View 4s2g on RCSB PDB site
Description: Joint X-ray/neutron structure of Trichoderma reesei xylanase II at pH 5.8
Class: hydrolase
Keywords: glycoside hydrolase, HYDROLASE
Deposited on 2015-01-20, released 2015-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAYNEUT
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: TRICHODERMA REESEI [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4s2ga_
  • Heterogens: IOD, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s2gA (A:)
    etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
    nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
    qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
    ssgsasitvs