![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Anaplasma marginale [TaxId:770] [277056] (3 PDB entries) |
![]() | Domain d4zina_: 4zin A: [277059] automated match to d3lf3a_ complexed with edo, so4 |
PDB Entry: 4zin (more details), 1.67 Å
SCOPe Domain Sequences for d4zina_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zina_ d.22.1.1 (A:) automated matches {Anaplasma marginale [TaxId: 770]} aiikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf mygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr gtnfpsdgpvmqkktmgxeassermypedgalkgeikqrlklkdgghydaevkttykakk pvqlpgaynvniklditshnedytiveqyeraegrhstg
Timeline for d4zina_: