![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries) |
![]() | Domain d3lf3a_: 3lf3 A: [180243] automated match to d1g7ka_ |
PDB Entry: 3lf3 (more details), 1.15 Å
SCOPe Domain Sequences for d3lf3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lf3a_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} nmaiikefmrfkvhvegsvnghefeiegegkgrpyegtqtaklkvtkggplpfawdilsp qfmygsrayvkhpadipdywklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvk lrgtnfpsdgpvmqkktmgweastermypedgalkgeikqrlklkdgghydaevkttyka kkpvqlpgaynvniklditshnedytiveqyersegrhstg
Timeline for d3lf3a_: