Lineage for d4y8ca_ (4y8c A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737039Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)
  7. 2737043Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
    Uniprot O76083 241-566
  8. 2737082Domain d4y8ca_: 4y8c A: [277034]
    automated match to d2hd1a_
    complexed with 49d, mg, zn

Details for d4y8ca_

PDB Entry: 4y8c (more details), 2.7 Å

PDB Description: crystal structure of phosphodiesterase 9 in complex with (s)-c33
PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4y8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8ca_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
kyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhd
nyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyq
inartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatd
marhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleey
fmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplw
esrdryeelkriddamkelqkk

SCOPe Domain Coordinates for d4y8ca_:

Click to download the PDB-style file with coordinates for d4y8ca_.
(The format of our PDB-style files is described here.)

Timeline for d4y8ca_: